PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100031230222
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 374aa    MW: 41715.6 Da    PI: 6.6778
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100031230222genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.2e-32187241155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   k r+rWt++LH+rFve+v++LGG++kAtPk+il+lm+ +gLt+ hvkSHLQkYR 
  Ote100031230222|100031230222 187 KSRIRWTQDLHDRFVECVNRLGGPDKATPKQILKLMDTEGLTIFHVKSHLQKYRN 241
                                   68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.09E-17184241IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-29184242IPR009057Homeodomain-like
PROSITE profilePS5129412.434184244IPR017930Myb domain
TIGRFAMsTIGR015573.4E-25187242IPR006447Myb domain, plants
PfamPF002493.9E-8191240IPR001005SANT/Myb domain
PfamPF143795.8E-18273320IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MKGIQHNLGS YSGDFPDISP QSYPAQQQSA SNQQHTRWNA GTIIGRIGSP AAAFCATEIA  60
MGLSHYDFPQ SDNLYPTKQT FHPSATHGLF GGSPARNEAD SQNYHGGSYR NHFINPSERE  120
QILHLKNKLL GDLDVSDGRS PSVSLDANQE LEVPQNLYAP HLLQFGRCLS SASMNSSSSP  180
AAVTSHKSRI RWTQDLHDRF VECVNRLGGP DKATPKQILK LMDTEGLTIF HVKSHLQKYR  240
NAKYMPESVE AAAKAEKKTN MNNEAQIDIK TGVQLKEALQ LQLDVQMRLH EQLEIQQNLQ  300
VRIEEQSKQL KMMFDQQQKT TTNLAETNHA NNICPNANSL STTVEDPEIL VLDGSDDDVV  360
MLSKISQKKE GNFY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075159.11e-135PREDICTED: protein PHR1-LIKE 1
TrEMBLA0A022RJM11e-115A0A022RJM1_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458